PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013904600.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 235aa    MW: 26201.1 Da    PI: 9.4248
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013904600.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-1894139348
                      SS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                      rWT+eE+ +l  +v+q+G++ +W++Ia+ +  gR++kqc++rw++++
   XP_013904600.1  94 RWTAEEHARLESLVRQYGTErNWALIAEGIS-GRSGKQCRERWLNHM 139
                      8******************************.*************96 PP

2Myb_DNA-binding23.61.2e-07145187145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +g+W ++E+  l+ ++++ G+  W+    ++  gRt++++k++w+
   XP_013904600.1 145 KGNWLADEEFHLALCHTLVGNQ-WSQHCTRLR-GRTENSIKNYWN 187
                      79******************99.***999999.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.38487143IPR017930Myb domain
SMARTSM007171.6E-1291141IPR001005SANT/Myb domain
SuperFamilySSF466893.14E-2193191IPR009057Homeodomain-like
PfamPF002493.2E-1694138IPR001005SANT/Myb domain
CDDcd001671.11E-1394139No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2194145IPR009057Homeodomain-like
PROSITE profilePS512948.649144194IPR017930Myb domain
SMARTSM007170.0012144192IPR001005SANT/Myb domain
PfamPF002494.7E-6145187IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.6E-13146193IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEVAGRPSTA SDDCEYLPPI AGYAAALPHI PIRRGVPRSG GGGDSDFEYE GSDSDYSDDS  60
TSAAGARRRR KAAPSMGIRK PSSGGAGGTR VLHRWTAEEH ARLESLVRQY GTERNWALIA  120
EGISGRSGKQ CRERWLNHMR DGIIKGNWLA DEEFHLALCH TLVGNQWSQH CTRLRGRTEN  180
SIKNYWNATL RSKQANKRRG FLWSYIDKVR GALDDEGLRH RAFADTMDHS LTHAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-249519310107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013904600.11e-174Myb-related protein A
TrEMBLA0A0D2NLJ31e-174A0A0D2NLJ3_9CHLO; Myb-related protein A
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1516114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11050.13e-30myb domain protein 64
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]